Issue link: https://www.balharbourdigital.com/i/1461738
98 BAL HARBOUR XXX Sarah Wetenhall H O T E L I E R As the owner of The Colony Hotel, the chic Palm Beach property with an WPOKUVCMCDNGRKPMHCÃCFG5CTCJ9GVGPJCNNKURCTVQHCTCTGƂGFITQWRQH YQOGPYJQTWPCNWZWT[JQURKVCNKV[DTCPF5JGIQVJGTECTGGTUVCTVKP0GY ;QTMYJGTGUJGURGPVOQTGVJCPCFGECFGYQTMKPIKPRWDNKETGNCVKQPUCPF OCTMGVKPIHQTHCUJKQPJQWUGUUWEJCU%CNXKP-NGKPCPF&QNEG)CDDCPC Wetenhall's entrepreneurial instincts took her to Palm Beach in 2016 where she DQWIJV6JG%QNQP[HTQOJGTHCVJGTKPNCYTGGPGTIK\KPIKVYKVJCUNGYQHFGUKIP WRITCFGUCPFEQQNEQNNCDQTCVKQPUtShivani Vora P O R T R A I T B Y N I C K M E L E Your Monday to Friday uniform includes: Jeans LÞ ÌâiÃvÕ>ÌÞ°>ÛiVÕÀÛiÃ]>`ÌiÞwÌ my body beautifully. I also wear a simple bodysuit by Hanro that's incredibly soft and has a tiny trim at the neck that makes it feel special. Then, there's my favorite Gucci blazer which has a striped ribbon ÌÀÆÌ«ÕÃÌ}iÌiÀ>ÞÕÌwÌ° Your ideal travel luggage: My Goyard Croisiere 45 bag that's custom-painted with my initials. It's a V>ÀÀÞÌ>̽ÃL}iÕ}ÌwÌiÛiÀÞÌ}ii` for a weekend trip. The perfect handbag for every day: My Chanel Deauville Tote, which I have in three colors. It's big enough to hold all of my stuff. Between everything I need for my kids, work and personal life, I have a lot of stuff. Plus, I love that it's made from fabric and so durable. The exhibit or event this spring and summer that you can't imagine missing: Central Park Conservancy's annual Hat Luncheon is such an iconic and well-loved event, plus a major fashion moment. What are three must-have items you take on every trip? Dr. Barbara Sturm Glow Drops to keep my skin dewy and fresh. Bottega Veneta Cassette cross- body bag, which keeps my hands free. Also, my iPad and Apple Smart Keyboard so I can work on the road. Favorite designers for special occasions: Oscar de la Renta, Valentino and Johanna Ortiz. All three make clothes that are feminine >`>ÛiyÜiÀÃ>`vÀÃ] but they feel fresh and are perfect for South Florida. What are your three must-have looks for the season? A Saint Laurent wool cardigan, Chanel's pink and black skirt suit and Valentino's tweed Pois dress. 6JGUPGCMGTUQTƃCVUVJCV[QW wear on repeat: Golden Goose sneakers. You can't beat the comfort, and they are so fashion forward. Also, Aquazzura's bow-tie L>iÌy>ÌÃ>`ƂiÝ>`Ài À> >ÀÌ>LÀ>`i`y>ÌÃ>`>ð The one pair of shoes that you must have this season: Aquazzura's Tres Mondaine pumps. I love the peekaboo motif and that the heel isn't too high or too low. They're VÀi`LÞÃiÝÞ° How about your go-to beach look? Without question Agua by Agua Bendita. Their swimwear combined with coordinating skirts and dresses totally blur the line between swim and street. I always pair them with a hat from Sarah Bray Bermuda. d Apple an work H l A c What's your favorite Bal Harbour Shops restaurant and dish? Ding's crispy chicken sandwich from Hillstone is my very favorite splurge after a day of shopping. It's crispy without being greasy and comes with an incredible spicy slaw. Golden Goose sneakers Valentino tweed Pois dress Valentino gown Bottega Veneta Cassette bag Aquazzura's Tres Mondaine pump Agua by Agua Bendita swimsuit, available at The Webster XXX Artist Tyler Mitchell shot Gucci's new Pineapple collection campaign at The Colony Hotel.